KCNMB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84110

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNMB2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNMB2. Peptide sequence: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNMB2 Antibody - BSA Free

Western Blot: KCNMB2 Antibody [NBP2-84110]

Western Blot: KCNMB2 Antibody [NBP2-84110]

Western Blot: KCNMB2 Antibody [NBP2-84110] - Host: Rabbit. Target Name: KCNMB2. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for KCNMB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNMB2

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Two variants encoding the same protein have been found for this gene.

Alternate Names

BK channel subunit beta-2, BKbeta2, calcium-activated potassium channel subunit beta-2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, Hbeta2, Hbeta3, k(VCA)beta-2, large conductance calcium-activated potassium channel beta 2 subunit, large-conductance Ca2+-activated K+ channel beta2 subunit, Maxi K channel subunit beta-2, MaxiK channel beta 2 subunit, MGC22431, potassium large conductance calcium-activated channel, subfamily M, beta member2, Slo-beta-2

Gene Symbol

KCNMB2

Additional KCNMB2 Products

Product Documents for KCNMB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNMB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNMB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNMB2 Antibody - BSA Free and earn rewards!

Have you used KCNMB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies