KCNT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85138

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNT2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNT2. Peptide sequence: TDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNT2 Antibody - BSA Free

Western Blot: KCNT2 Antibody [NBP2-85138]

Western Blot: KCNT2 Antibody [NBP2-85138]

Western Blot: KCNT2 Antibody [NBP2-85138] - Host: Rabbit. Target Name: KCNT2. Sample Tissue: Human ACHN Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for KCNT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNT2

FUCNTION: Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. Activated by high intracellular sodium and chloride levels. Channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.; Subcellular location: Cell membrane; Multi-pass membrane protein

Alternate Names

KCa4.2, MGC119610, MGC119611, MGC119612, potassium channel subfamily T member 2, potassium channel, subfamily T, member 2, Sequence like an intermediate conductance potassium channel subunit, SLICKMGC119613, SLO2.1, sodium activated potassium channel, sodium and chloride activated ATP sensitive potassium channel, sodium- and chloride-activated ATP-sensitive potassium channel, Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1, sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)

Gene Symbol

KCNT2

Additional KCNT2 Products

Product Documents for KCNT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNT2 Antibody - BSA Free and earn rewards!

Have you used KCNT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies