KCTD7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80094

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KCTD7 Antibody - BSA Free

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Host: Rabbit. Target Name: KCTD7. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for KCTD7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCTD7

The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1; MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain (Van Bogaert et al., 2007 [PubMed 17455289]).[supplied by OMIM]

Alternate Names

BTB/POZ domain-containing protein KCTD7, EPM3FLJ32069, FLJ45891, potassium channel tetramerisation domain containing 7

Gene Symbol

KCTD7

Additional KCTD7 Products

Product Documents for KCTD7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCTD7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCTD7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCTD7 Antibody - BSA Free and earn rewards!

Have you used KCTD7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for KCTD7 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We recently purchased NBP1-80094 and would like to generate a blocking peptide. Could you tell me the peptide that was used to generate the antibody?

    A: The peptide sequence used to synthesize the antibody is as follows: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...