KCTD7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80094

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KCTD7 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KCTD7 Antibody - BSA Free

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Host: Rabbit. Target Name: KCTD7. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094]

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for KCTD7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCTD7

The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1; MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain (Van Bogaert et al., 2007 [PubMed 17455289]).[supplied by OMIM]

Alternate Names

BTB/POZ domain-containing protein KCTD7, EPM3FLJ32069, FLJ45891, potassium channel tetramerisation domain containing 7

Gene Symbol

KCTD7

UniProt

NP_694578 (Human)

Additional KCTD7 Products

Product Documents for KCTD7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KCTD7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCTD7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCTD7 Antibody - BSA Free and earn rewards!

Have you used KCTD7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for KCTD7 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All

  • Q: We recently purchased NBP1-80094 and would like to generate a blocking peptide. Could you tell me the peptide that was used to generate the antibody?

    A: The peptide sequence used to synthesize the antibody is as follows: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies