Kirrel1/NEPH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91309

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human KIRREL. Peptide sequence FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Kirrel1/NEPH1 Antibody - BSA Free

Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309]

Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309]

Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309]

Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309]

Western Blot: Kirrel1/NEPH1 Antibody [NBP1-91309] - WB Suggested Anti-KIRREL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Applications for Kirrel1/NEPH1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kirrel1/NEPH1

Kirrel (kin of irregular chiasm-1-like) proteins, also known as the NEPH (nephrin-like) family, are type I transmembrane glycoproteins within the immunoglobulin superfamily. Kirrel1 (NEPH1), Kirrel2 (NEPH3, Filtrin, NLG-1) and Kirrel3 (NEPH2, kirre) share 34 - 44% amino acid (aa) identity, and all interact with nephrin, podocin and the adaptor molecule ZO-1 (1, 4). All can be found in podocytes of the kidney glomerulus, and play a role in barrier function in the slit diaphragm. (2-6). Kirrel1 can also be found in central nervous system neurons, pancreas and placenta, Kirrel2 in pancreatic islet beta cells, brain and lymph nodes, and Kirrel3 in the brain and bone marrow, typically at sites where nephrin is also expressed.

Long Name

Kin of Irregular Chiasm-like 1

Alternate Names

KIRREL, NEPH1

Gene Symbol

KIRREL1

UniProt

Additional Kirrel1/NEPH1 Products

Product Documents for Kirrel1/NEPH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kirrel1/NEPH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Kirrel1/NEPH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kirrel1/NEPH1 Antibody - BSA Free and earn rewards!

Have you used Kirrel1/NEPH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Kirrel1/NEPH1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am interested in obtaining the blocking peptide for the Kirrel antibody, cat number NBP1-91309. Could you please provide me with the reference number for order?

    A: You can order KIRREL Blocking Peptide (the middle region of protein) using NBP1-91309PEP as a catalog number. This peptide is supplied as lyophilized powder (100 ug).

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...