KLF11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10447

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KLF11 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_848134). Peptide sequence PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KLF11 Antibody - BSA Free

Western Blot: KLF11 Antibody [NBP3-10447]

Western Blot: KLF11 Antibody [NBP3-10447]

Western Blot: KLF11 Antibody [NBP3-10447] - Western blot analysis of KLF11 in Mouse Brain as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for KLF11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLF11

Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis

Alternate Names

FKLFFKLF1, Krueppel-like factor 11, Kruppel-like factor 11, MODY7TGFB-inducible early growth response protein 2, TIEG-2, TIEG2TGFB inducible early growth response 2, Tieg3, Transforming growth factor-beta-inducible early growth response protein 2

Gene Symbol

KLF11

Additional KLF11 Products

Product Documents for KLF11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KLF11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLF11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLF11 Antibody - BSA Free and earn rewards!

Have you used KLF11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies