KLHDC2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04568

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all KLHDC2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 306-406 of human KLHDC2 (NP_055130.1). EWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KLHDC2 Antibody - Azide and BSA Free

Western Blot: KLHDC2 AntibodyAzide and BSA Free [NBP3-04568]

Western Blot: KLHDC2 AntibodyAzide and BSA Free [NBP3-04568]

Western Blot: KLHDC2 Antibody [NBP3-04568] - Western blot analysis of extracts of K-562 cells, using KLHDC2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 150s.
KLHDC2 Antibody - Azide and BSA Free

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] -

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using KLHDC2 Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
KLHDC2 Antibody - Azide and BSA Free

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] -

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using KLHDC2 Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Applications for KLHDC2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KLHDC2

KLHDC2, also known as Kelch domain-containing protein 2, is a 46kDa 406 amino acid protein with a shorter 28kDa 249 isoform produced by alternative splicing. KLHDC2 interfers with CREB3-DNA binding by repressing CREB3-mediated transcription. Current research is being conducted on KLHDC2 in relation to Legg-Calve-Perthes disease, hepatocellular carcinoma and herpes simplex. KLHDC2 is linked to the reflex, excretion, micturition, cytokine production and lactation pathways where it interacts with DDX19B, SFN, STRN4, EZH2 and UBXN7.

Long Name

Kelch Domain Containing 2

Alternate Names

HCA33, HCLP-1, HCLP1, LCP

Gene Symbol

KLHDC2

Additional KLHDC2 Products

Product Documents for KLHDC2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KLHDC2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLHDC2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KLHDC2 Antibody - Azide and BSA Free and earn rewards!

Have you used KLHDC2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies