KRTAP1-5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79847

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human KRTAP1-5The immunogen for this antibody is KRTAP1-5. Peptide sequence TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KRTAP1-5 Antibody - BSA Free

Western Blot: KRTAP1-5 Antibody [NBP1-79847]

Western Blot: KRTAP1-5 Antibody [NBP1-79847]

Western Blot: KRTAP1-5 Antibody [NBP1-79847] - Human Fetal Brain Lysate, concentration 1 ug/ml.

Applications for KRTAP1-5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KRTAP1-5

This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq]

Alternate Names

KAP1.5High sulfur keratin-associated protein 1.5, keratin associated protein 1.5, keratin associated protein 1-5, Keratin-associated protein 1.5, keratin-associated protein 1-5, KRTAP1.5, KRTAP-15, MGC126604

Gene Symbol

KRTAP1-5

Additional KRTAP1-5 Products

Product Documents for KRTAP1-5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KRTAP1-5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KRTAP1-5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KRTAP1-5 Antibody - BSA Free and earn rewards!

Have you used KRTAP1-5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...