Ku80/XRCC5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56408

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to XRCC5 (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; 80kDa)) The peptide sequence was selected from the C terminal of XRCC5. Peptide sequence GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ku80/XRCC5 Antibody - BSA Free

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408] - analysis of HeLa cell lysate (30ug) using anti-Ku80 antibody. Image from verified customer review.
Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408]

Western Blot: Ku80/XRCC5 Antibody [NBP1-56408] - Titration: 1 ug/ml Positive Control: Human pancreatic cancer cell line MiaPaca-2 and Panc-1.

Applications for Ku80/XRCC5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-56408 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ku80/XRCC5

XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

Long Name

Lupus Ku Autoantigen Protein 86

Alternate Names

CTC85, G22P2, KARP1, Ku86, KUB2, NFIV, XRCC5

Gene Symbol

XRCC5

UniProt

Additional Ku80/XRCC5 Products

Product Documents for Ku80/XRCC5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ku80/XRCC5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ku80/XRCC5 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Ku80/XRCC5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 的 1 review Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Hela Cell Lysate
    Species: Human
    Verified Customer | Posted 10/07/2014
    Ku-80 WB in HeLa cells
    Ku80/XRCC5 Antibody - BSA Free NBP1-56408

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...