Lefty-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86700

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Lefty-2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Lefty-2. Peptide sequence: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit Lefty-2 Antibody - BSA Free (NBP2-86700) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Lefty-2 Antibody - BSA Free

Western Blot: Lefty-2 Antibody [NBP2-86700]

Western Blot: Lefty-2 Antibody [NBP2-86700]

Western Blot: Lefty-2 Antibody [NBP2-86700] - Host: Rabbit. Target Name: LEFTY2. Sample Type: Thymus Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for Lefty-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lefty-2

Lefty proteins are novel TGF-beta ligands that function as antagonists of Nodal signaling. The expression of Lefty proteins on the left side of the developing mouse embryo earned this protein family its name. Two genes exist in mouse (Lefty-1 and Lefty-2) and two in humans (Lefty-A and Lefty-B). By amino acid sequence, human Lefty-A and Lefty-B are more similar to each other (96%) than to either Lefty-1 or Lefty-2 in the mouse (81-82%). The Leftys contains some of the features of the cysteine-knot structure conserved among TGF-beta-related proteins, but also some structural differences. Specifically, they lack the alpha-helical segment important for ligand dimerization as well as the cysteine residue involved in stabilization of dimers.

Alternate Names

Ebaf, TGF-beta 4, TGFB4

Gene Symbol

LEFTY2

Additional Lefty-2 Products

Product Documents for Lefty-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lefty-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lefty-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lefty-2 Antibody - BSA Free and earn rewards!

Have you used Lefty-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies