Lipase Member K Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09522

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Lipase Member K Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Lipase Member K (NP_001073987). Peptide sequence LLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Lipase Member K Antibody - BSA Free

Western Blot: Lipase Member K Antibody [NBP3-09522]

Western Blot: Lipase Member K Antibody [NBP3-09522]

Western Blot: Lipase Member K Antibody [NBP3-09522] - Western blot analysis of Lipase Member K in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for Lipase Member K Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lipase Member K

Alternate Names

bA186O14.2, EC 3.1.1, EC 3.1.1.13, Lipase K, Lipase, Family Member K, Lipase-Like Abhydrolase Domain-Containing Protein 2, Lipase-Like, Ab-Hydrolase Domain Containing 2, LIPK, LIPL2

Gene Symbol

LIPK

Additional Lipase Member K Products

Product Documents for Lipase Member K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lipase Member K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lipase Member K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lipase Member K Antibody - BSA Free and earn rewards!

Have you used Lipase Member K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies