Lipin 1 Antibody (4Y2U3)

Novus Biologicals | Catalog # NBP3-16169

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4Y2U3 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693). MHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lipin 1 Antibody (4Y2U3)

Western Blot: Lipin 1 Antibody (4Y2U3) [NBP3-16169]

Western Blot: Lipin 1 Antibody (4Y2U3) [NBP3-16169]

Western Blot: Lipin 1 Antibody (4Y2U3) [NBP3-16169] - Western blot analysis of extracts of various cell lines, using Lipin 1 Rabbit mAb (NBP3-16169) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Lipin 1 Antibody (4Y2U3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lipin 1

LPIN1 (Lipin-1) is crucial for normal adipose tissue development and metabolism. LPIN1 selectively activates a subset of PGC-225; target pathways, including fatty acid oxidation and mitochondrial oxidative phosphorylation by inducing expression of the nuclear receptor PPAR 225. LPIN1 also inactivates the lipogenic program and suppresses circulating lipid levels. An abundance of LPIN1 promotes fat accumulation and insulin sensitivity. A deficiency in LPIN1 may deter normal adipose tissue development, resulting in insulin resistance and lipodystrophy, a heterogeneous group of disorders characterized by loss of body fat, fatty liver, hypertriglyceridemia and insulin resistance.

Long Name

Phosphatidate Phosphatase LPIN1

Alternate Names

LPIN1

Gene Symbol

LPIN1

Additional Lipin 1 Products

Product Documents for Lipin 1 Antibody (4Y2U3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lipin 1 Antibody (4Y2U3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Lipin 1 Antibody (4Y2U3)

There are currently no reviews for this product. Be the first to review Lipin 1 Antibody (4Y2U3) and earn rewards!

Have you used Lipin 1 Antibody (4Y2U3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

mTOR Signaling Pathway
mTOR Signaling Pathway Thumbnail