LSM10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83164

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LSM10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat LSM10. Peptide sequence: MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LSM10 Antibody - BSA Free

Western Blot: LSM10 Antibody [NBP2-83164]

Western Blot: LSM10 Antibody [NBP2-83164]

Western Blot: LSM10 Antibody [NBP2-83164] - Host: Rabbit. Target Name: Lsm10. Sample Type: Rat Testis lysates. Antibody Dilution: 1.0ug/ml

Applications for LSM10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LSM10

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNAlevels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progressionfrom G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histonepre-mRNA in a U7 snRNP dependent manner

Alternate Names

LSM10, U7 small nuclear RNA associated, MGC15749, MST074, MSTP074, U7 snRNA-associated Sm-like protein LSm10, U7 snRNP-specific Sm-like protein LSM10

Gene Symbol

LSM10

Additional LSM10 Products

Product Documents for LSM10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LSM10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LSM10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LSM10 Antibody - BSA Free and earn rewards!

Have you used LSM10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies