Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

Novus Biologicals | Catalog # NBP3-16799

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A9G6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 550-650 of human Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A (O75164). GDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

Western Blot: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6) [NBP3-16799]

Western Blot: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6) [NBP3-16799]

Western Blot: Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6) [NBP3-16799] - Western blot analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Rabbit mAb (NBP3-16799) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysine (K)-specific Demethylase 4A/KDM4A

JMJD2A is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.

Alternate Names

JHDM3A, JMJD2, JMJD2A, KDM4A, Lysine (K)specific Demethylase 4A

Gene Symbol

KDM4A

Additional Lysine (K)-specific Demethylase 4A/KDM4A Products

Product Documents for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)

There are currently no reviews for this product. Be the first to review Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6) and earn rewards!

Have you used Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...