MED26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10479

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MED26 (NP_004822). Peptide sequence TAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEET

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MED26 Antibody - BSA Free

Western Blot: MED26 Antibody [NBP3-10479]

Western Blot: MED26 Antibody [NBP3-10479]

Western Blot: MED26 Antibody [NBP3-10479] - Western blot analysis using NBP3-10479 on Human 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for MED26 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED26

In mammalian cells, transcription is regulated in part by high molecular weight coactivating complexes that mediate signals between transcriptional activators and RNA polymerase. These complexes include CRSP (for cofactor required for Sp1 activation), which is required, in conjunction with TAFIIs, for transcriptional activation by Sp1. CRSP is ubiquitously expressed in various tissues and functions as a multimeric complex that consists of nine distinct subunits. Several members of the CRSP family share sequence similarity with multiple components of the yeast transcriptional mediator proteins, including CRSP150, which is related to yeast Rgr1, and CRSP70, which is similar to the elongation factor TFIIS. CRSP77 and CRSP150 are also related to proteins within the putative murine mediator complex, while CRSP130 and CRSP34 are largely unrelated to either murine or yeast proteins. CRSP subunits also associate with larger multimeric coactivaor complexes, including ARC/DRI, which binds directly to SREBP and nuclear hormone receptors to facilitate transcription, and with NAT, a polymerase II-interacting complex that represses activated transcription.

Alternate Names

Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26

Gene Symbol

MED26

Additional MED26 Products

Product Documents for MED26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MED26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED26 Antibody - BSA Free and earn rewards!

Have you used MED26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...