Meis homeobox 3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16055

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Meis homeobox 3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 325-375 of human Meis homeobox 3 (NP_001287988.1). IDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Meis homeobox 3 Antibody - Azide and BSA Free

Western Blot: Meis homeobox 3 AntibodyAzide and BSA Free [NBP3-16055]

Western Blot: Meis homeobox 3 AntibodyAzide and BSA Free [NBP3-16055]

Western Blot: Meis homeobox 3 Antibody [NBP3-16055] - Western blot analysis of extracts of various cell lines, using Meis homeobox 3 antibody (NBP3-16055) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Meis homeobox 3 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Meis homeobox 3

MEIS3, also known as Homeobox protein Meis3, has 3 isoforms, a 375 amino acid isoform that is 41 kDa, a 421 amino acid isoform that is 46 kDa, and a 358 amino acid isoform that is 39 kDa, and is nucleus located. Little is currently known about its function. Studies are performed on the relationship of this protein to neuronitis. MEIS3 protein involvement has been observed with relation to HOXA13 in the regulation of transcription, DNA-dependent, negative regulation of apoptotic process, and positive regulation of protein kinase B signaling cascade pathways.

Alternate Names

DKFZp547H236, Meis homeobox 3, Meis1, myeloid ecotropic viral integration site 1 homolog 3, Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse), Meis1-related protein 2, MRG2homeobox protein Meis3

Gene Symbol

MEIS3

Additional Meis homeobox 3 Products

Product Documents for Meis homeobox 3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Meis homeobox 3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Meis homeobox 3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Meis homeobox 3 Antibody - Azide and BSA Free and earn rewards!

Have you used Meis homeobox 3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies