Melanoma antigen family E1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91489

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Melanoma antigen family E1 Antibody - BSA Free

Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]

Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]

Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.
Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]

Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]

Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489] - WB Suggested Anti-Magee1 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Spleen

Applications for Melanoma antigen family E1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melanoma antigen family E1

Alternate Names

Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1

Gene Symbol

MAGEE1

Additional Melanoma antigen family E1 Products

Product Documents for Melanoma antigen family E1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melanoma antigen family E1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Melanoma antigen family E1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melanoma antigen family E1 Antibody - BSA Free and earn rewards!

Have you used Melanoma antigen family E1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Melanoma antigen family E1 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: I need to find out if your anti-MAG-E1 antibody (NBP1-91489) will be compatible with my MAGE-E1 cDNA expression vector. Will you please give me the amino acid sequence you used to generate this antibody?

    A: The immunogen sequence is within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...