Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84159

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Melatonin R1A/MT1/MTNR1A. Peptide sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159]

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159]

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159] - WB Suggested Anti-MTNR1A Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159]

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159]

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP2-84159] - Host: Rabbit. Target Name: HIRIP3. Sample Type: 293T. Antibody Dilution: 1.0ug/ml

Applications for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melatonin R1A/MT1/MTNR1A

Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]

Long Name

Melatonin Receptor 1A

Alternate Names

Mel-1A-R, MelatoninR1A, MT1, MTNR1A

Gene Symbol

MTNR1A

Additional Melatonin R1A/MT1/MTNR1A Products

Product Documents for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melatonin R1A/MT1/MTNR1A Antibody - BSA Free and earn rewards!

Have you used Melatonin R1A/MT1/MTNR1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.

    A:

    At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...