mitochondrial ribosomal protein L30 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83209

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all mitochondrial ribosomal protein L30 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human mitochondrial ribosomal protein L30. Peptide sequence: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for mitochondrial ribosomal protein L30 Antibody - BSA Free

Western Blot: mitochondrial ribosomal protein L30 Antibody [NBP2-83209]

Western Blot: mitochondrial ribosomal protein L30 Antibody [NBP2-83209]

Western Blot: mitochondrial ribosomal protein L30 Antibody [NBP2-83209] - Host: Rabbit. Target Name: MRPL30. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml

Applications for mitochondrial ribosomal protein L30 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: mitochondrial ribosomal protein L30

MRPL30, also known as 39 S ribosomal protein L30, mitochondrial, consists of three isoforms of sizes 18.5 kDa, 21.8 kDa, and 15.2 kDa and is involved in translations as a part of mitochondrial ribosomes. Currently, there is no research being conducted to link the protein to diseases. The protein interacts with WNK1 in translation pathways.

Alternate Names

39S ribosomal protein L30, mitochondrial, L28mt, L30mt, mitochondrial ribosomal protein L30, MRP-L28FLJ44438, MRPL28MGC3314,39S ribosomal protein L28, mitochondrial, MRP-L30, RPML28MGC24095

Gene Symbol

MRPL30

Additional mitochondrial ribosomal protein L30 Products

Product Documents for mitochondrial ribosomal protein L30 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for mitochondrial ribosomal protein L30 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mitochondrial ribosomal protein L30 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mitochondrial ribosomal protein L30 Antibody - BSA Free and earn rewards!

Have you used mitochondrial ribosomal protein L30 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies