MKRN3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85295

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MKRN3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat MKRN3. Peptide sequence: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MKRN3 Antibody - BSA Free

Western Blot: MKRN3 Antibody [NBP2-85295]

Western Blot: MKRN3 Antibody [NBP2-85295]

Western Blot: MKRN3 Antibody [NBP2-85295] - Host: Rabbit. Target Name: Mkrn3. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

Applications for MKRN3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MKRN3

MKRN3, also known as Probable E3 ubiquitin-protein ligase makorin-3, is a 507 amino acid protein that is 56 kDa, contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs, and acts as a catalyzer of the covalent attachment of ubiquitin moieties onto substrate proteins. Current research is being performed on this protein involvement in Prader-Willi syndrome, Angelman syndrome, Canavan disease, and intellectual disability. This protein is necessary for protein ubiquitination forming interaction with TSG101, UBE2D2, UBE2D3, UBE2I, UBE2N, UBE2V1, UBE2W, UBE2U, UBE2D1, UBE2D4, UBE2E1, UBE2E2, UBE2H, UBE2K, UBE2L3, UBE2V2, UBE2E3, C11orf57, ENKD1, LRSAM1, MDM2, and over 20 other proteins.

Alternate Names

EC 6.3.2.-, makorin ring finger protein 3, MGC88288, RNF63D15S9, ZFP127RING finger protein 63, Zinc finger protein 127, ZNF127probable E3 ubiquitin-protein ligase makorin-3

Gene Symbol

MKRN3

Additional MKRN3 Products

Product Documents for MKRN3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MKRN3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MKRN3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MKRN3 Antibody - BSA Free and earn rewards!

Have you used MKRN3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies