MMADHC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54708

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MMADHC. The peptide sequence was selected from the middle region of MMADHC (NP_056517). Peptide sequence RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MMADHC Antibody - BSA Free

Western Blot: MMADHC Antibody [NBP1-54708]

Western Blot: MMADHC Antibody [NBP1-54708]

Western Blot: MMADHC Antibody [NBP1-54708] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for MMADHC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMADHC

The function of C2orf25 remains unknown.Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism (Coelho et al., 2008 [PubMed 18385497]).[supplied by OMIM].

Alternate Names

cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial

Entrez Gene IDs

27249 (Human)

Gene Symbol

MMADHC

UniProt

Additional MMADHC Products

Product Documents for MMADHC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMADHC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MMADHC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMADHC Antibody - BSA Free and earn rewards!

Have you used MMADHC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for MMADHC Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: My questions is about product number NBP1-54708. I'm trying to find information about what secondary antibody to use against this product. What secondary antibody was used in the Western blot associated with the antibody? Also, would you be able to tell me the method of detection for the Western blot as well (i.e. chemiluminescence or colorimetric)?

    A: The secondary antibody used in the Western blot was goat-anti-rabbit-HRP at a dilution of 1:5000 and the detection method used was chemiluminescence.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...