MNAB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55060

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MNAB Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RC3H2(ring finger and CCCH-type zinc finger domains 2) The peptide sequence was selected from the middle region of RC3H2. Peptide sequence YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MNAB Antibody - BSA Free

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060] - Human Adult Placenta.
Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Lung.
Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060]

Western Blot: MNAB Antibody [NBP1-55060] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RC3H2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Applications for MNAB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MNAB

The function of this protein remains unknown.

Alternate Names

FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164

Gene Symbol

RC3H2

Additional MNAB Products

Product Documents for MNAB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MNAB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MNAB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MNAB Antibody - BSA Free and earn rewards!

Have you used MNAB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies