MOBKL2C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84168

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MOBKL2C Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MOBKL2C. Peptide sequence: MAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MOBKL2C Antibody - BSA Free

Western Blot: MOBKL2C Antibody [NBP2-84168]

Western Blot: MOBKL2C Antibody [NBP2-84168]

Western Blot: MOBKL2C Antibody [NBP2-84168] - Host: Rabbit. Target Name: MOB3C. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MOBKL2C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MOBKL2C

MOBKL2C is encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

MGC26743, Mob1 homolog 2C, MOB1, Mps One Binder kinase activator-like 2C (yeast), MOB3Cmps one binder kinase activator-like 2C, Protein Mob3C

Gene Symbol

MOB3C

Additional MOBKL2C Products

Product Documents for MOBKL2C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MOBKL2C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MOBKL2C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MOBKL2C Antibody - BSA Free and earn rewards!

Have you used MOBKL2C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies