Mre11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-95102

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 290-485 of human MRE11 (NP_005582.1). KGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mre11 Antibody - BSA Free

Western Blot: Mre11 AntibodyAzide and BSA Free [NBP2-95102]

Western Blot: Mre11 AntibodyAzide and BSA Free [NBP2-95102]

Western Blot: Mre11 Antibody [NBP2-95102] - Western blot analysis of extracts of various cell lines, using Mre11 antibody (NBP2-95102) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunoprecipitation: Mre11 Antibody - Azide and BSA Free [NBP2-95102]

Immunoprecipitation: Mre11 Antibody - Azide and BSA Free [NBP2-95102]

Immunoprecipitation: Mre11 Antibody [NBP2-95102] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Mre11 antibody (NBP2-95102). Western blot was performed from the immunoprecipitate using Mre11 antibody (NBP2-95102) at a dilution of 1:1000.

Applications for Mre11 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Mre11

Mre11 (double-strand break repair protein MRE11A) is an important component of MRN/X complex (Mre11, Rad50, and Nbs1/Xrs2), playing a central role in double-strand break (DSB) repair, DNA recombination, telomere integrity maintenance, meiotic cell division, and viral infection. Mre11 and Rad50 comprise the catalytic component of the MRN complex with Rad50 involved in ATP hydrolysis and Mre11 functioning as a nuclease having both single-strand endonuclease and double-strand-specific 3'-5' exonuclease activity (1). The MRN complex is also involved in DNA damage signaling via activation of ATM kinase and in telomeres, where it may modulate t-loop formation (2). In addition, Mre11 is a component of the BASC complex (BRCA1, MSH2, MSH6, MLH1, ATM, BLM, RAD50, MRE11A and NBN) and interacts with DCLRE1C/Artemis as well as DCLRE1B/Apollo (3).

The MRN assembles as a hetero-hexamer consisting of 2 RAD50 subunits, 2 MRE11 nucleases, and 2 NBS1 subunits, specific to eukaryotes. Mre11 is highly conserved with the N-terminal region of the human protein sharing approximately 50% amino acid sequence identity with the yeast ortholog. Human Mre11 has 3 known isoforms with the predominant isoform having a theoretical molecular weight of 80.6kDa. This nuclear localized protein has high expression in proliferating tissues. Defects in Mre11 can lead to genomic instability, telomere shortening, aberrant meiosis, hypersensitivity to DNA damage, and ataxia telangiectasia-like disorder (ATLD). MRN expression has been associated with the prognosis of cancer and MRN mutants have been linked to cancer susceptibility in ovarian cancer and glioma (4, 5).

References

1. Paull TT. (2018) 20 Years of Mre11 Biology: No End in Sight. Mol Cell. 71(3):419-427. PMID: 30057197

2. Syed A, Tainer JA. (2018) The MRE11-RAD50-NBS1 Complex Conducts the Orchestration of Damage Signaling and Outcomes to Stress in DNA Replication and Repair. Annu Rev Biochem. 87:263-294. PMID: 29709199

3. Wang Y, Cortez D, Yazdi P, Neff N, Elledge SJ, Qin J. (2000) BASC, a super complex of BRCA1-associated proteins involved in the recognition and repair of aberrant DNA structures. Genes Dev. 14(8):927-39. PMID: 10783165

4. Kim JH, Grosbart M, Anand R, Wyman C, Cejka P, Petrini JHJ. (2017) The Mre11-Nbs1 Interface Is Essential for Viability and Tumor Suppression. Cell Rep. 18(2):496-507. PMID: 28076792

5. Bian L, Meng Y, Zhang M, Li D. (2019) MRE11-RAD50-NBS1 complex alterations and DNA damage response: implications for cancer treatment. Mol Cancer. 18(1):169. PMID: 31767017

Long Name

Meiotic Recombination 11 Homolog A

Alternate Names

MRE11A

Gene Symbol

MRE11

Additional Mre11 Products

Product Documents for Mre11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mre11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Mre11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mre11 Antibody - BSA Free and earn rewards!

Have you used Mre11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Mre11 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: Could you recommend an optimal Mre11 positive control for Western blot among your products?

    A: NBL1-13219 would be the best product since it is intended for this purpose.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...