MRP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59806

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ABCC3(ATP-binding cassette, sub-family C (CFTR/MRP), member 3) The peptide sequence was selected from the middle region of ABCC3. Peptide sequence KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

168 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MRP3 Antibody - BSA Free

Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806]

Western Blot: MRP3 Antibody [NBP1-59806] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Applications for MRP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRP3

ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

ATP-binding cassette sub-family C member 3

Alternate Names

ABCC3, CMOAT2, EC 7.6.2.3, MLP2, MOAT-D

Gene Symbol

ABCC3

UniProt

Additional MRP3 Products

Product Documents for MRP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRP3 Antibody - BSA Free and earn rewards!

Have you used MRP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...