MRPL14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87822

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL14. Peptide sequence: MTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAIAQNFV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL14 Antibody - BSA Free

Western Blot: MRPL14 Antibody [NBP2-87822]

Western Blot: MRPL14 Antibody [NBP2-87822]

Western Blot: MRPL14 Antibody [NBP2-87822] - Host: Rabbit. Target Name: MRPL14. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL14

MRPL14, also known as 39 S ribosomal protein L14, mitochondrial, is a 15.9 kDa, 145 amino acid protein that is utilized in assembled ribosomes to form an intersubunit bridge. When the protein bins with the protein MALSU1, bridge formation is blocked and translation is repressed. There is no current research being conducted with this protein. The protein interacts with TNIK, MYC, ARHGAP1, ICT, and POLR2C.

Alternate Names

L14mt, L32mt, mitochondrial ribosomal protein L14, MRPL32MGC70566,39S ribosomal protein L32, mitochondrial, MRP-L32MRP-L14, RMPL32, RPML3239S ribosomal protein L14, mitochondrial

Gene Symbol

MRPL14

Additional MRPL14 Products

Product Documents for MRPL14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL14 Antibody - BSA Free and earn rewards!

Have you used MRPL14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies