MRPS16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85325

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPS16 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS16. Peptide sequence: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPS16 Antibody - BSA Free

Western Blot: MRPS16 Antibody [NBP2-85325]

Western Blot: MRPS16 Antibody [NBP2-85325]

Western Blot: MRPS16 Antibody [NBP2-85325] - Host: Rabbit. Target Name: MRPS16. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPS16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS16

MRPS16, or Mitochondrial Ribosomal Protein S16, consists of a 137 amino acid isoform that is 15 kDa, and is involved in the manufacture of proteins within the mitochondria. Current research is being conducted on the relationship between MRPS16 and several diseases and disorders, including combined oxidative phosphorylation deficiency, mycobacterium tuberculosis, corpus callosum, pneumonia, lactic acidosis, Alzheimer's disease, and encephalomyopathy. The protein has not been linked to any pathways, but has been found to interact with ICT1, PHLDA3, SLX4, MRPS14, and MRPS2.

Alternate Names

CGI-132, COXPD2, FLJ22062, FLJ40972, mitochondrial ribosomal protein S16, MRP-S16,28S ribosomal protein S16, mitochondrial, RPMS16, S16mt

Gene Symbol

MRPS16

Additional MRPS16 Products

Product Documents for MRPS16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS16 Antibody - BSA Free and earn rewards!

Have you used MRPS16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies