MSL3L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09964

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MSL3L1 (NP_523353). Peptide sequence STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MSL3L1 Antibody - BSA Free

Western Blot: MSL3L1 Antibody [NBP3-09964]

Western Blot: MSL3L1 Antibody [NBP3-09964]

Western Blot: MSL3L1 Antibody [NBP3-09964] - Western blot analysis of MSL3L1 in Human Stomach Tumor lysates. Antibody dilution at 1ug/ml

Applications for MSL3L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MSL3L1

MSL3L1 encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms.

Alternate Names

male-specific lethal 3 homolog, male-specific lethal 3 homolog (Drosophila), male-specific lethal 3-like 1 (Drosophila), male-specific lethal-3 (Drosophila)-like 1, Male-specific lethal-3 homolog 1, Male-specific lethal-3 protein-like 1, MSL3L1DKFZp586J1822, MSL3-like 1

Gene Symbol

MSL3

Additional MSL3L1 Products

Product Documents for MSL3L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MSL3L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MSL3L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MSL3L1 Antibody - BSA Free and earn rewards!

Have you used MSL3L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...