Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85340

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHRM1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Muscarinic Acetylcholine Receptor M1/CHRM1. Peptide sequence: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-85340]

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-85340]

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-85340] - WB Suggested Anti-CHRM1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Bladder

Applications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHRM1

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.

Long Name

Cholinergic Receptor Muscarinic 1

Alternate Names

HM1, M1, M1R, mAChR M1

Gene Symbol

CHRM1

Additional CHRM1 Products

Product Documents for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free and earn rewards!

Have you used Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies