Musculin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10419

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Musculin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Musculin (NP_034957). Peptide sequence IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Musculin Antibody - BSA Free

Western Blot: Musculin Antibody [NBP3-10419]

Western Blot: Musculin Antibody [NBP3-10419]

Western Blot: Musculin Antibody [NBP3-10419] - Western blot analysis of Musculin in Mouse Small Instestine as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for Musculin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Musculin

Differentiation of myogenic cells is regulated by multiple positively and negatively acting factors. One well characterized family of helix-loop-helix (HLH) proteins, known to play an important role in the regulation of muscle cell development, includes MyoD, myogenin and musculin (also designated MyoR). Members of this group of transcription factors form heterodimers with products of a more widely expressed family of bHLH genes, the E family, which consists of at least three distinct genes: E2A, IF2 and HEB. MyoD-E or musculin-E heterodimers bind avidly to consensus E box motifs, which are functionally important elements in the promoter regions of many musclespecific terminal differentiation genes. MyoD complexes potently induce transcriptional activation, while musculin complexes bind adjacent to MyoD DNA-binding regions to represses MyoD activity, which then results in the delayed expression of muscle-specific genes. Musculin is highly expressed in undifferentiated and proliferating myoblasts in culture, and its expression is down regulated during myogenesis and at the onset of terminal differentiation

Alternate Names

ABF1, ABF-1activated B-cell factor 1, homolog of mouse musculin, Activated B-cell factor 1, BHLHA22, bHLHa22activated B-cell factor-1, Class A basic helix-loop-helix protein 22, musculin, musculin (activated B-cell factor-1), MYOR

Gene Symbol

MSC

Additional Musculin Products

Product Documents for Musculin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Musculin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Musculin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Musculin Antibody - BSA Free and earn rewards!

Have you used Musculin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies