MVP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52931

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MVP(major vault protein) The peptide sequence was selected from the N terminal of MVP. Peptide sequence MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MVP Antibody - BSA Free

Western Blot: MVP Antibody [NBP1-52931]

Western Blot: MVP Antibody [NBP1-52931]

Western Blot: MVP Antibody [NBP1-52931] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Applications for MVP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MVP

MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Alternate Names

LRPVAULT1, Lung resistance-related protein, major vault protein

Gene Symbol

MVP

UniProt

Additional MVP Products

Product Documents for MVP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MVP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MVP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MVP Antibody - BSA Free and earn rewards!

Have you used MVP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for MVP Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?

    A: At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...