MYL9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55383

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MYL9 (myosin, light chain 9, regulatory). The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31066574).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYL9 Antibody - BSA Free

Western Blot: MYL9 Antibody [NBP1-55383]

Western Blot: MYL9 Antibody [NBP1-55383]

Western Blot: MYL9 Antibody [NBP1-55383] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for MYL9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYL9

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505

Gene Symbol

MYL9

Additional MYL9 Products

Product Documents for MYL9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYL9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MYL9 Antibody - BSA Free

Customer Reviews for MYL9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYL9 Antibody - BSA Free and earn rewards!

Have you used MYL9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...