Myosin light chain kinase Antibody (1J2U2)

Novus Biologicals | Catalog # NBP3-16282

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1J2U2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human Myosin light chain kinase (Q15746). VAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myosin light chain kinase Antibody (1J2U2)

Western Blot: Myosin light chain kinase Antibody (1J2U2) [NBP3-16282]

Western Blot: Myosin light chain kinase Antibody (1J2U2) [NBP3-16282]

Western Blot: Myosin light chain kinase Antibody (1J2U2) [NBP3-16282] - Western blot analysis of extracts of various cell lines, using Myosin light chain kinase Rabbit mAb (NBP3-16282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Myosin light chain kinase Antibody (1J2U2)

Western Blot: Myosin light chain kinase Antibody (1J2U2) [NBP3-16282] -

Western Blot: Myosin light chain kinase Antibody (1J2U2) [NBP3-16282] - Western blot analysis of extracts of various cell lines, using Myosin light chain kinase Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for Myosin light chain kinase Antibody (1J2U2)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin light chain kinase

Myosin light chain kinase (MLCK) is a serine/threonine kinase that belongs to CaM Kinases (Ca++/Calmodulin-dependent protein kinases) family. MLCK is involved in the regulation of myosin activity during smooth muscle contraction. At increased level of Ca2+, rapid binding of Ca2+ to Calmodulin (CaM) occurs, triggering MLCK activation. Once activated, MLCK phosphorylates myosin light chain (MLC) and leading to cross-bridges cycling and generation of the contractile force (1). MLCK has been implicated in the regulation of endothelial and vascular permeability and in signaling pathway which leads to fibroblast apoptosis (2).

Long Name

Myosin light chain kinase, smooth muscle

Alternate Names

KRP, MLCK1, MYLK, MYLK1, smMLCK

Gene Symbol

MYLK

Additional Myosin light chain kinase Products

Product Documents for Myosin light chain kinase Antibody (1J2U2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myosin light chain kinase Antibody (1J2U2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin light chain kinase Antibody (1J2U2)

There are currently no reviews for this product. Be the first to review Myosin light chain kinase Antibody (1J2U2) and earn rewards!

Have you used Myosin light chain kinase Antibody (1J2U2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...