NARFL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85357

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NARFL Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NARFL. Peptide sequence: MACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NARFL Antibody - BSA Free

Western Blot: NARFL Antibody [NBP2-85357]

Western Blot: NARFL Antibody [NBP2-85357]

Western Blot: NARFL Antibody [NBP2-85357] - Host: Rabbit. Target Name: NARFL. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NARFL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NARFL

NARFL is a component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation ofextramitochondrial Fe/S proteins. Seems to negatively regulate the level of HIF1A expression, although this effectcould be indirect

Alternate Names

cytosolic Fe-S cluster assembly factor NARFL, FLJ21988, HPRN, IOP1Protein related to Narf, Iron-only hydrogenase-like protein 1, LET1 like/JFP15, nuclear prelamin A recognition factor-like, Nuclear prelamin A recognition factor-like protein, PRNLET1L

Gene Symbol

CIAO3

Additional NARFL Products

Product Documents for NARFL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NARFL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NARFL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NARFL Antibody - BSA Free and earn rewards!

Have you used NARFL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies