NDUFA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09939

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NDUFA4 (NP_002480). Peptide sequence YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFA4 Antibody - BSA Free

Western Blot: NDUFA4 Antibody [NBP3-09939]

Western Blot: NDUFA4 Antibody [NBP3-09939]

Western Blot: NDUFA4 Antibody [NBP3-09939] - Western blot analysis of NDUFA4 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for NDUFA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 1 using NBP3-09939 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFA4

NDUFA4 is encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Alternate Names

CI-9k, CI-MLRQ, Complex I 9kDa subunit, Complex I-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4, NADH-ubiquinone oxidoreductase MLRQ subunit

Gene Symbol

NDUFA4

Additional NDUFA4 Products

Product Documents for NDUFA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA4 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used NDUFA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • NDUFA4 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: human brain lysate
    Species: Human
    Verified Customer | Posted 04/06/2023
    NDUFA4 Antibodies NBP3-09939, ProteinSimple Western Blot on Jess Instrument; 3 and 1 microgram of human brain tissue lysate was tested with the antibodies diluted 10 times. No specific signal was detected at any exposure.
    NDUFA4 Antibody - BSA Free NBP3-09939
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...