NDUFB9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88940

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFB9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFB9 Antibody - BSA Free

Western Blot: NDUFB9 Antibody [NBP1-88940]

Western Blot: NDUFB9 Antibody [NBP1-88940]

Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: NDUFB9 Antibody [NBP1-88940]

Immunocytochemistry/ Immunofluorescence: NDUFB9 Antibody [NBP1-88940]

Immunocytochemistry/Immunofluorescence: NDUFB9 Antibody [NBP1-88940] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFB9 Antibody [NBP1-88940]

Immunohistochemistry-Paraffin: NDUFB9 Antibody [NBP1-88940]

Immunohistochemistry-Paraffin: NDUFB9 Antibody [NBP1-88940] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: NDUFB9 Antibody [NBP1-88940]

Western Blot: NDUFB9 Antibody [NBP1-88940]

Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Applications for NDUFB9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFB9

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

B22, CI-B22, complex I B22 subunit, Complex I-B22, FLJ22885, LYR motif-containing protein 3, LYRM3DKFZp566O173, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9, NADH-ubiquinone oxidoreductase B22 subunit, UQOR22NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9 (22kD, B22)

Gene Symbol

NDUFB9

Additional NDUFB9 Products

Product Documents for NDUFB9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFB9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFB9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFB9 Antibody - BSA Free and earn rewards!

Have you used NDUFB9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies