NEDD4L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54974

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NEDD4L Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NEDD4L(neural precursor cell expressed, developmentally down-regulated 4-like) The peptide sequence was selected from the middle region of NEDD4L. Peptide sequence TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NEDD4L Antibody - BSA Free

Western Blot: NEDD4L Antibody [NBP1-54974]

Western Blot: NEDD4L Antibody [NBP1-54974]

Western Blot: NEDD4L Antibody [NBP1-54974] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.
Western Blot: NEDD4L Antibody [NBP1-54974]

Western Blot: NEDD4L Antibody [NBP1-54974]

Western Blot: NEDD4L Antibody [NBP1-54974] - Human cystic fibrosis epithelial.

Applications for NEDD4L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NEDD4L

NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation. NEDD4L promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, EAAT1 or CLC5. NEDD4L also promotes ubiquitination and degradation of SGK.

Alternate Names

E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed, developmentally down-regulated gene 4-like, RSP5ubiquitin-protein ligase Rsp5

Gene Symbol

NEDD4L

UniProt

Q96PU5-5 (Human)

Additional NEDD4L Products

Product Documents for NEDD4L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NEDD4L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEDD4L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NEDD4L Antibody - BSA Free and earn rewards!

Have you used NEDD4L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies