NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09991

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_001018169.1). Peptide sequence KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP3-09991]

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP3-09991]

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP3-09991] - Western blot analysis of NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse Heart lysates. Antibody dilution at 1.0ug/ml

Applications for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NEDD8 Activating Enzyme (APPBP1/UBA3)

NAE1 is encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene.

Long Name

Amyloid beta Precursor Protein-binding Protein 1/Ubiquitin Like Modifier Activating Enzyme 3

Alternate Names

A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1

Gene Symbol

NAE1

Additional NEDD8 Activating Enzyme (APPBP1/UBA3) Products

Product Documents for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free and earn rewards!

Have you used NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...