Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86730

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Nicotinic Acetylcholine R alpha 10/CHRNA10. Peptide sequence: GGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86730]

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86730]

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86730] - Host: Rabbit. Target Name: CHRNA10. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 10/CHRNA10

Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma

Long Name

Nicotinic Acetylcholine Receptor alpha 10

Alternate Names

CHRNA10, NACHRA10, Nicotinic Acetylcholine Ra10

Gene Symbol

CHRNA10

Additional Nicotinic Acetylcholine R alpha 10/CHRNA10 Products

Product Documents for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...