Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87917

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Nicotinic Acetylcholine R alpha 3/CHRNA3. Peptide sequence: EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87917]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87917]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87917] - WB Suggested Anti-CHRNA3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: COLO205 cell lysate

Applications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 3/CHRNA3

The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.

Long Name

Nicotinic Acetylcholine Receptor alpha 3

Alternate Names

CHRNA3, LNCR2, NACHRA3, Nicotinic Acetylcholine Ra3, PAOD2

Gene Symbol

CHRNA3

Additional Nicotinic Acetylcholine R alpha 3/CHRNA3 Products

Product Documents for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...