Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69122

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26904947).

Specificity

This product is specific to Subunit or Isoform: alpha-5.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP1-69122]

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP1-69122]

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP1-69122]

Applications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 1 using NBP1-69122 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 5/CHRNA5

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Long Name

Nicotinic Acetylcholine Receptor alpha 5

Alternate Names

CHRNA5, NACHRA5, Nicotinic Acetylcholine Ra5

Gene Symbol

CHRNA5

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Product Documents for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Customer Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody
    Name: Emily Thompson
    Application: Western Blot
    Sample Tested: human cortex, D54 glioma cell, U251 glioma cell line; whole cell lysate, patient derived human glioblastoma cell lines, patient-derived human glioblastoma lines, human D54 malignant glioma cell line and control human cortex
    Species: Human
    Verified Customer | Posted 12/13/2019
    Control human ctx and glioblastoma cell lines and patient derived lines were loaded at 30ug per lane. Primary antibody was applied at 1:250 overnight in 5% non fat milk at 4C.
    30ug of protein lysate loaded; 1:250; secondary 1:1000 Gt anti-Rb HRP; fempto to develop
    Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free NBP1-69122

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...