Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84180

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Nicotinic Acetylcholine R alpha 6/CHRNA6. Peptide sequence: MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody [NBP2-84180]

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody [NBP2-84180]

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody [NBP2-84180] - WB Suggested Anti-CHRNA6 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 6/CHRNA6

Nicotinic acetylcholine receptors (nAChRs, AChRs) are protein complexes made up of protein subunits that coassemble to form an ion channel. This ion channel is gated through the binding of the neurotransmitter acetylcholine (ACh) to its ligand-binding site on the AChR. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA6 (cholinergic nicotinic receptor alpha polypeptide 6) is a neuronal acetylcholine receptor protein.

Long Name

Nicotinic Acetylcholine Receptor alpha 6

Alternate Names

CHRNA6, Nicotinic Acetylcholine Ra6

Gene Symbol

CHRNA6

Additional Nicotinic Acetylcholine R alpha 6/CHRNA6 Products

Product Documents for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...