Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79952

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human CHRNG. Peptide sequence NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine Receptor gamma Antibody [NBP1-79952]

Western Blot: Nicotinic Acetylcholine Receptor gamma Antibody [NBP1-79952]

Western Blot: Nicotinic Acetylcholine Receptor gamma Antibody [NBP1-79952] - MCF-7 whole cell lysates, concentration 1 ug/ml.

Applications for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 1 using NBP1-79952 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R gamma/CHRNG

After binding acetylcholine, the acetylcholine receptor responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Long Name

Nicotinic Acetylcholine Receptor gamma

Alternate Names

ACHRG, CHRNG

Gene Symbol

CHRNG

UniProt

Additional Nicotinic Acetylcholine R gamma/CHRNG Products

Product Documents for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Customer Reviews for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Nicotinic Acetylcholine Receptor gamma Antibody
    Name: Andrea Salzinger
    Application: Immunocytochemistry
    Sample Tested: Human iPSC Motor Neurons and Human NMJ containing organoid
    Species: Human
    Verified Customer | Posted 02/06/2022
    Immunofluorescent staining against gamma subunit of Acetylcholine receptors. FastMyHC: Fast myosin heavy chain (muscle fibres), Btx: Bungarotoxin (Stains alpha subunit of AChR), AChRG: gamma subunit of AChR
    Neuromuscular junction (NMJ) organoids were fixed in 4% PFA for 3h and subsequently washed 3x with PBS. Cryoprotection was carried out by incubation in 30% Sucrose overnight, followed by embedding in a 1:1 mixture of 30% Sucrose:OCT and cryosection into 20 m slices, collected on superfrost glass slides. For IF staining, samples were incubated for 10min with 0.25% Triton X-100 to ensure membrane permeabilization, followed by blocking with 5% bovine serum albumin, 0.25% Triton X-100 in PBS for 1h, RT to avoid unspecific binding of primary antibodies. Subsequently, samples were incubated with primary antibodies in blocking solution overnight, 4°C. The following day, samples were washed 2x with PBS and 1x with PBS-T (0.1% Tween 20) and incubated with appropriate fluorescent secondary antibodies for 1h, RT. Nuclei were counter stained with DAPI for 10min, followed by subsequent washing with 2x PBS and 1x PBS-T. Samples were mounted using Fluorosave. Images were taken with Zeiss LSMZ10 confocal microscope and analysed.
    Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free NBP1-79952
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

FAQs for Nicotinic Acetylcholine Receptor gamma Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...