NMNAT-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52973

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NMNAT-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NMNAT-1 (nicotinamide nucleotide adenylyltransferase 1). The peptide sequence was selected from the N terminal of NMNAT1 (NP_073624). Peptide sequence PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in multiple pieces of scientific literature.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NMNAT-1 Antibody - BSA Free

Western Blot: NMNAT-1 Antibody [NBP1-52973]

Western Blot: NMNAT-1 Antibody [NBP1-52973]

Western Blot: NMNAT-1 Antibody [NBP1-52973] - Reccomended Titration: 0.25 ug/ml Positive Control: HepG2 cell lysate
Western Blot: NMNAT-1 Antibody [NBP1-52973]

Western Blot: NMNAT-1 Antibody [NBP1-52973]

Western Blot: NMNAT-1 Antibody [NBP1-52973] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml

Applications for NMNAT-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMNAT-1

The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Nicotinamide mononucleotide adenylyltransferase-1

Alternate Names

NMN adenylyltransferase 1, NMNAT1, PNAT1

Entrez Gene IDs

64802 (Human)

Gene Symbol

NMNAT1

UniProt

Q9HAN9

Additional NMNAT-1 Products

Product Documents for NMNAT-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NMNAT-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NMNAT-1 Antibody - BSA Free

Customer Reviews for NMNAT-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NMNAT-1 Antibody - BSA Free and earn rewards!

Have you used NMNAT-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies