Nogo Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69284

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to Nogo The peptide sequence was selected from the middle region of Nogo. Peptide sequence RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nogo Antibody - BSA Free

Western Blot: Nogo Antibody [NBP1-69284]

Western Blot: Nogo Antibody [NBP1-69284]

Western Blot: NOGO Antibody [NBP1-69284] - This Anti-RTN4 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 0.25ug/ml.

Applications for Nogo Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nogo

Nogo belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. Nogo is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.

Alternate Names

ASY, Foocen, Human NogoA, KIAA0886, My043 protein, Nbla00271, Nbla10545, neurite growth inhibitor 220, Neurite outgrowth inhibitor, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, NI220/250, Nogo protein, NOGO-A, Nogo-B, NOGOC, Nogo-C, NOGORTN4-B1, NSP, NSP-CL, reticulon 4, reticulon 5, reticulon-4, Reticulon-5, RTN4-A, RTN4-B2, RTN4-C, RTN-X

Gene Symbol

RTN4

UniProt

Additional Nogo Products

Product Documents for Nogo Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nogo Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nogo Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nogo Antibody - BSA Free and earn rewards!

Have you used Nogo Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...