NOL6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57280

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NOL6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NOL6(nucleolar protein family 6 (RNA-associated)) The peptide sequence was selected from the N terminal of NOL6. Peptide sequence SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NOL6 Antibody - BSA Free

Western Blot: NOL6 Antibody [NBP1-57280]

Western Blot: NOL6 Antibody [NBP1-57280]

Western Blot: NOL6 Antibody [NBP1-57280] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for NOL6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOL6

NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.

Alternate Names

bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838, Nrap, nucleolar protein 6, nucleolar protein family 6 (RNA-associated), Nucleolar RNA-associated protein, UTP22

Gene Symbol

NOL6

UniProt

Q9H6R4 (Human)

Additional NOL6 Products

Product Documents for NOL6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOL6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOL6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOL6 Antibody - BSA Free and earn rewards!

Have you used NOL6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies