NSUN5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58249

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NSUN5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NSUN5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NSUN5 Antibody [NBP2-58249]

Immunocytochemistry/ Immunofluorescence: NSUN5 Antibody [NBP2-58249]

Immunocytochemistry/Immunofluorescence: NSUN5 Antibody [NBP2-58249] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Applications for NSUN5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NSUN5

NSUN5 encodes a protein with similarity to p120 (NOL1), a 120-kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

EC 2.1.1.-, FLJ10267, member 5A, MGC986, NOL1, NOL1/NOP2/Sun domain family member 5, NOL1/NOP2/Sun domain family, member 5, NOL1R(NOL1), NOL1-related protein, NOP2/Sun domain family, member 5, NSUN5A, p120, putative methyltransferase NSUN5, WBSCR20, WBSCR20A, Williams-Beuren syndrome chromosomal region 20A protein, Williams-Beuren syndrome critical region protein 20 copy A, Ynl022cL

Gene Symbol

NSUN5

Additional NSUN5 Products

Product Documents for NSUN5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NSUN5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NSUN5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSUN5 Antibody - BSA Free and earn rewards!

Have you used NSUN5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies