NUPL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09417

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NUPL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Nupl1 (NP_620791). Peptide sequence GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NUPL1 Antibody - BSA Free

Western Blot: NUPL1 Antibody [NBP3-09417]

Western Blot: NUPL1 Antibody [NBP3-09417]

Western Blot: NUPL1 Antibody [NBP3-09417] - Western blot analysis of NUPL1 in Rat Thymus lysates. Antibody dilution at 1.0ug/ml

Applications for NUPL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUPL1

NUPL1 encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Alternate Names

KIAA0410PRO2463, nucleoporin like 1, nucleoporin p58/p45, Nucleoporin-like protein 1

Gene Symbol

NUP58

Additional NUPL1 Products

Product Documents for NUPL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUPL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUPL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUPL1 Antibody - BSA Free and earn rewards!

Have you used NUPL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies