Ocular development associated gene Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87979

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Ocular development associated gene Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Ocular development associated gene. Peptide sequence: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ocular development associated gene Antibody - BSA Free

Western Blot: Ocular development associated gene Antibody [NBP2-87979]

Western Blot: Ocular development associated gene Antibody [NBP2-87979]

Western Blot: Ocular development associated gene Antibody [NBP2-87979] - WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells

Applications for Ocular development associated gene Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ocular development associated gene

Alternate Names

FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2

Gene Symbol

GATAD1

Additional Ocular development associated gene Products

Product Documents for Ocular development associated gene Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ocular development associated gene Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ocular development associated gene Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ocular development associated gene Antibody - BSA Free and earn rewards!

Have you used Ocular development associated gene Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies