OR10A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09844

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR10A3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A3 (NP_001003745). Peptide sequence YGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNPLIYSLRNSEMKRTL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR10A3 Antibody - BSA Free

Western Blot: OR10A3 Antibody [NBP3-09844]

Western Blot: OR10A3 Antibody [NBP3-09844]

Western Blot: OR10A3 Antibody [NBP3-09844] - Western blot analysis of OR10A3 in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR10A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR10A3

Olfactory Receptor, Family 10, Subfamily A, Member 3 (OR10A3) is a member of the G-protein-coupled receptors (GPCR). Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Alternate Names

HTPCRX12HSHTPCRX12, olfactory receptor 10A3, Olfactory receptor OR11-97, olfactory receptor, family 10, subfamily A, member 3

Gene Symbol

OR10A3

Additional OR10A3 Products

Product Documents for OR10A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR10A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR10A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR10A3 Antibody - BSA Free and earn rewards!

Have you used OR10A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies