OR1F1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09758

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 (NP_036492.1). Peptide sequence FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR1F1 Antibody - BSA Free

Western Blot: OR1F1 Antibody [NBP3-09758]

Western Blot: OR1F1 Antibody [NBP3-09758]

Western Blot: OR1F1 Antibody [NBP3-09758] - Western blot analysis of OR1F1 in Jurkat Whole Cell. Antibody dilution at 1.0ug/ml

Applications for OR1F1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR1F1

OR1F1, also known as Olfactory receptor 1F1, is a 34.9 kDa, 312 amino acid protein that is involved in receiving signals from odor molecules and triggering a neuronal response that will initiate the perception of smell. Diseases such as neuronitis and familial Mediterranean fever are currently being researched with this protein. The protein interacts with GNAL, GNGT1, OR2C1, OR10A3, and OR52E6 proteins in olfactory and GPCR signaling pathways.

Alternate Names

Olfactory receptor 16-35, olfactory receptor 1F1, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory receptor 1F8, Olfactory receptor 1F9, Olfactory receptor OR16-4, olfactory receptor, family 1, subfamily F, member 1, olfactory receptor, family 1, subfamily F, member 13 pseudogene, olfactory receptor, family 1, subfamily F, member 4, olfactory receptor, family 1, subfamily F, member 5, olfactory receptor, family 1, subfamily F, member 6, olfactory receptor, family 1, subfamily F, member 7, olfactory receptor, family 1, subfamily F, member 9, Olfmf, OLFMFolfactory receptor, family 1, subfamily F, member 10, OR16-35, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F10, OR1F13P, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR3-145, ORL1023

Gene Symbol

OR1F1

Additional OR1F1 Products

Product Documents for OR1F1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR1F1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR1F1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR1F1 Antibody - BSA Free and earn rewards!

Have you used OR1F1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...